Anti-CHST4
Catalog Number:
ATA-HPA021955
- Images (8)
| Article Name: | Anti-CHST4 |
| Biozol Catalog Number: | ATA-HPA021955 |
| Supplier Catalog Number: | HPA021955 |
| Alternative Catalog Number: | ATA-HPA021955-100,ATA-HPA021955-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HEC-GLCNAC-6-ST, LSST |
| carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 |
| Anti-CHST4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10164 |
| UniProt: | Q8NCG5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHST4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human gallbladder and kidney tissues using HPA021955 antibody. Corresponding CHST4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows positivity in bile duct cells. |
|
|
Immunohistochemical staining of human kidney shows no positivity as expected. |
|
|
HPA021955-100ul |
|
|
HPA021955-100ul |
|
|
HPA021955-100ul |
Product Guarantee and Expert Support
