Anti-SLC47A1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA021987
Artikelname: Anti-SLC47A1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA021987
Hersteller Artikelnummer: HPA021987
Alternativnummer: ATA-HPA021987-100,ATA-HPA021987-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ10847, MATE1
solute carrier family 47 (multidrug and toxin extrusion), member 1
Anti-SLC47A1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 55244
UniProt: Q96FL8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC47A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA021987 antibody. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.
HPA021987
HPA021987
HPA021987