Anti-SLC47A1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SLC47A1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA021987
• Supplier Catalog Number: HPA021987
• Alternative Catalog Number: ATA-HPA021987-100,ATA-HPA021987-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ10847, MATE1

Product Description

solute carrier family 47 (multidrug and toxin extrusion), member 1

Additional Information

Anti-SLC47A1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 55244
• UniProt: Q96FL8
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLC47A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA021987 antibody. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.

HPA021987

HPA021987

HPA021987