Anti-SLC47A1

Catalog Number: ATA-HPA021987
Article Name: Anti-SLC47A1
Biozol Catalog Number: ATA-HPA021987
Supplier Catalog Number: HPA021987
Alternative Catalog Number: ATA-HPA021987-100,ATA-HPA021987-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10847, MATE1
solute carrier family 47 (multidrug and toxin extrusion), member 1
Anti-SLC47A1
Clonality: Polyclonal
Isotype: IgG
NCBI: 55244
UniProt: Q96FL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SLC47A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA021987 antibody. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.
HPA021987-100ul
HPA021987-100ul
HPA021987-100ul