Anti-KIF9
Artikelnummer:
ATA-HPA022031
- Bilder (7)
| Artikelname: | Anti-KIF9 |
| Artikelnummer: | ATA-HPA022031 |
| Hersteller Artikelnummer: | HPA022031 |
| Alternativnummer: | ATA-HPA022031-100,ATA-HPA022031-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC104186 |
| kinesin family member 9 |
| Anti-KIF9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64147 |
| UniProt: | Q9HAQ2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KIF9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli. |
|
|
Immunohistochemical staining of human testis shows cytopalsmic positivity in cells in seminiferous ducts and Leydig cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405393) |
|
|
HPA022031-100ul |
|
|
|
|
|
HPA022031-100ul |
|
|
HPA022031-100ul |
Produktgarantie und fachkundiger Support
