Anti-KIF9

Catalog Number: ATA-HPA022031
Article Name: Anti-KIF9
Biozol Catalog Number: ATA-HPA022031
Supplier Catalog Number: HPA022031
Alternative Catalog Number: ATA-HPA022031-100,ATA-HPA022031-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC104186
kinesin family member 9
Anti-KIF9
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 64147
UniProt: Q9HAQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: KIF9
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli.
Immunohistochemical staining of human testis shows cytopalsmic positivity in cells in seminiferous ducts and Leydig cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405393)
HPA022031-100ul
HPA022031-100ul
HPA022031-100ul