Anti-CDK5RAP3
Artikelnummer:
ATA-HPA022141
- Bilder (7)
| Artikelname: | Anti-CDK5RAP3 |
| Artikelnummer: | ATA-HPA022141 |
| Hersteller Artikelnummer: | HPA022141 |
| Alternativnummer: | ATA-HPA022141-100,ATA-HPA022141-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114 |
| CDK5 regulatory subunit associated protein 3 |
| Anti-CDK5RAP3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80279 |
| UniProt: | Q96JB5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDK5RAP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol. |
|
|
Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDK5RAP3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA022141-100ul |
|
|
HPA022141-100ul |
|
|
HPA022141-100ul |
Produktgarantie und fachkundiger Support
