Anti-CDK5RAP3
Catalog Number:
ATA-HPA022141
- Images (7)
| Article Name: | Anti-CDK5RAP3 |
| Biozol Catalog Number: | ATA-HPA022141 |
| Supplier Catalog Number: | HPA022141 |
| Alternative Catalog Number: | ATA-HPA022141-100,ATA-HPA022141-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114 |
| CDK5 regulatory subunit associated protein 3 |
| Anti-CDK5RAP3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 80279 |
| UniProt: | Q96JB5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDK5RAP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol. |
|
|
Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDK5RAP3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA022141-100ul |
|
|
HPA022141-100ul |
|
|
HPA022141-100ul |
Product Guarantee and Expert Support
