Anti-PERP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA022269
- Bilder (9)
| Artikelname: | Anti-PERP Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA022269 |
| Hersteller Artikelnummer: | HPA022269 |
| Alternativnummer: | ATA-HPA022269-100,ATA-HPA022269-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW |
| PERP, TP53 apoptosis effector |
| Anti-PERP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64065 |
| UniProt: | Q96FX8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PERP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA022269 antibody. Corresponding PERP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows no positivity as expected. |
|
|
Immunohistochemical staining of human esophagus shows very weak membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human lymph node shows no positivity as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected. |
|
|
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in stratum corneum. |
|
|
HPA022269 |
|
|
HPA022269 |
|
|
HPA022269 |
Produktgarantie und fachkundiger Support
