Anti-PERP

Artikelnummer: ATA-HPA022269
Artikelname: Anti-PERP
Artikelnummer: ATA-HPA022269
Hersteller Artikelnummer: HPA022269
Alternativnummer: ATA-HPA022269-100,ATA-HPA022269-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW
PERP, TP53 apoptosis effector
Anti-PERP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 64065
UniProt: Q96FX8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PERP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA022269 antibody. Corresponding PERP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows no positivity as expected.
Immunohistochemical staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.
Immunohistochemical staining of human lymph node shows no positivity as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in stratum corneum.
HPA022269-100ul
HPA022269-100ul
HPA022269-100ul