Anti-PERP

Catalog Number: ATA-HPA022269
Article Name: Anti-PERP
Biozol Catalog Number: ATA-HPA022269
Supplier Catalog Number: HPA022269
Alternative Catalog Number: ATA-HPA022269-100,ATA-HPA022269-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW
PERP, TP53 apoptosis effector
Anti-PERP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 64065
UniProt: Q96FX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PERP
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA022269 antibody. Corresponding PERP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows no positivity as expected.
Immunohistochemical staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.
Immunohistochemical staining of human lymph node shows no positivity as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in stratum corneum.
HPA022269-100ul
HPA022269-100ul
HPA022269-100ul