Anti-PERP Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA022269
- Images (9)
| Article Name: | Anti-PERP Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA022269 |
| Supplier Catalog Number: | HPA022269 |
| Alternative Catalog Number: | ATA-HPA022269-100,ATA-HPA022269-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW |
| PERP, TP53 apoptosis effector |
| Anti-PERP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 64065 |
| UniProt: | Q96FX8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PERP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA022269 antibody. Corresponding PERP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows no positivity as expected. |
|
|
Immunohistochemical staining of human esophagus shows very weak membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human lymph node shows no positivity as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected. |
|
|
Immunohistochemical staining of human skin shows moderate to strong membranous positivity in stratum corneum. |
|
|
HPA022269 |
|
|
HPA022269 |
|
|
HPA022269 |
Product Guarantee and Expert Support
