Anti-PPM1D Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA022277
Artikelname: Anti-PPM1D Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA022277
Hersteller Artikelnummer: HPA022277
Alternativnummer: ATA-HPA022277-100,ATA-HPA022277-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PP2C-DELTA, Wip1
protein phosphatase, Mg2+/Mn2+ dependent, 1D
Anti-PPM1D
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8493
UniProt: O15297
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PPM1D
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in cells in white matter.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA022277
HPA022277
HPA022277