Anti-PPM1D
Artikelnummer:
ATA-HPA022277
- Bilder (9)
| Artikelname: | Anti-PPM1D |
| Artikelnummer: | ATA-HPA022277 |
| Hersteller Artikelnummer: | HPA022277 |
| Alternativnummer: | ATA-HPA022277-100,ATA-HPA022277-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PP2C-DELTA, Wip1 |
| protein phosphatase, Mg2+/Mn2+ dependent, 1D |
| Anti-PPM1D |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8493 |
| UniProt: | O15297 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPM1D |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in cells in white matter. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA022277-100ul |
|
|
|
|
|
HPA022277-100ul |
|
|
HPA022277-100ul |
Produktgarantie und fachkundiger Support
