Anti-PPM1D

Catalog Number: ATA-HPA022277
Article Name: Anti-PPM1D
Biozol Catalog Number: ATA-HPA022277
Supplier Catalog Number: HPA022277
Alternative Catalog Number: ATA-HPA022277-100,ATA-HPA022277-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PP2C-DELTA, Wip1
protein phosphatase, Mg2+/Mn2+ dependent, 1D
Anti-PPM1D
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8493
UniProt: O15297
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PPM1D
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemical staining of human liver shows moderate to strong nuclear positivity in hepatocytes.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in cells in white matter.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA022277-100ul
HPA022277-100ul
HPA022277-100ul