Anti-TPH1

Artikelnummer: ATA-HPA022483
Artikelname: Anti-TPH1
Artikelnummer: ATA-HPA022483
Hersteller Artikelnummer: HPA022483
Alternativnummer: ATA-HPA022483-100,ATA-HPA022483-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TPH, TPRH
tryptophan hydroxylase 1
Anti-TPH1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7166
UniProt: P17752
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TPH1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human small intestine and liver tissues using HPA022483 antibody. Corresponding TPH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA022483-100ul
HPA022483-100ul
HPA022483-100ul