Anti-TPH1

Catalog Number: ATA-HPA022483
Article Name: Anti-TPH1
Biozol Catalog Number: ATA-HPA022483
Supplier Catalog Number: HPA022483
Alternative Catalog Number: ATA-HPA022483-100,ATA-HPA022483-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TPH, TPRH
tryptophan hydroxylase 1
Anti-TPH1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7166
UniProt: P17752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TPH1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human small intestine and liver tissues using HPA022483 antibody. Corresponding TPH1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA022483-100ul
HPA022483-100ul
HPA022483-100ul