Anti-TPH1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TPH1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA022483
• Supplier Catalog Number: HPA022483
• Alternative Catalog Number: ATA-HPA022483-100,ATA-HPA022483-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: TPH, TPRH

Product Description

tryptophan hydroxylase 1

Additional Information

Anti-TPH1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 7166
• UniProt: P17752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TPH1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human small intestine and liver tissues using HPA022483 antibody. Corresponding TPH1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

HPA022483

HPA022483

HPA022483