Anti-CCDC40 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA022974
Artikelname: Anti-CCDC40 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA022974
Hersteller Artikelnummer: HPA022974
Alternativnummer: ATA-HPA022974-100,ATA-HPA022974-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640
coiled-coil domain containing 40
Anti-CCDC40
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 55036
UniProt: Q4G0X9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CCDC40
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.
Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-CCDC40 antibody. Corresponding CCDC40 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA022974
HPA022974
HPA022974