Anti-CCDC40 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CCDC40 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA022974
• Supplier Catalog Number: HPA022974
• Alternative Catalog Number: ATA-HPA022974-100,ATA-HPA022974-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640

Product Description

coiled-coil domain containing 40

Additional Information

Anti-CCDC40

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 55036
• UniProt: Q4G0X9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CCDC40
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.

Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using Anti-CCDC40 antibody. Corresponding CCDC40 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

HPA022974

HPA022974

HPA022974