Anti-CBX2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA023083
Artikelname: Anti-CBX2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA023083
Hersteller Artikelnummer: HPA023083
Alternativnummer: ATA-HPA023083-100,ATA-HPA023083-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CDCA6, MGC10561
chromobox homolog 2
Anti-CBX2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84733
UniProt: Q14781
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CBX2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA023083
HPA023083
HPA023083