Anti-CBX2

Catalog Number: ATA-HPA023083
Article Name: Anti-CBX2
Biozol Catalog Number: ATA-HPA023083
Supplier Catalog Number: HPA023083
Alternative Catalog Number: ATA-HPA023083-100,ATA-HPA023083-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CDCA6, MGC10561
chromobox homolog 2
Anti-CBX2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84733
UniProt: Q14781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CBX2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA023083-100ul
HPA023083-100ul
HPA023083-100ul