Anti-CBX2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CBX2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023083
• Supplier Catalog Number: HPA023083
• Alternative Catalog Number: ATA-HPA023083-100,ATA-HPA023083-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CDCA6, MGC10561

Product Description

chromobox homolog 2

Additional Information

Anti-CBX2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 84733
• UniProt: Q14781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CBX2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

HPA023083

HPA023083

HPA023083