Anti-ZNF366 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA023128
- Bilder (0)
| Artikelname: | Anti-ZNF366 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA023128 |
| Hersteller Artikelnummer: | HPA023128 |
| Alternativnummer: | ATA-HPA023128-100,ATA-HPA023128-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ39796 |
| Klonalität: | Polyclonal |
| NCBI: | 167465 |
| UniProt: | Q8N895 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | STKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERK |
| Target-Kategorie: | ZNF366 |
Produktgarantie und fachkundiger Support
