Anti-ZNF366 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA023128
| Article Name: |
Anti-ZNF366 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA023128 |
| Supplier Catalog Number: |
HPA023128 |
| Alternative Catalog Number: |
ATA-HPA023128-100,ATA-HPA023128-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLJ39796 |
| Clonality: |
Polyclonal |
| NCBI: |
167465 |
| UniProt: |
Q8N895 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
STKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERK |
| Target: |
ZNF366 |