Anti-GSDMA Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA023313
Artikelname: Anti-GSDMA Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA023313
Hersteller Artikelnummer: HPA023313
Alternativnummer: ATA-HPA023313-100,ATA-HPA023313-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ39120, GSDM, GSDM1
gasdermin A
Anti-GSDMA
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 284110
UniProt: Q96QA5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GSDMA
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA023313 antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody HPA023313 (A) shows similar protein distribution across tissues to independent antibody HPA064826 (B).
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemical staining of human lymph node using Anti-GSDMA antibody HPA023313.
Immunohistochemical staining of human skin, hairy using Anti-GSDMA antibody HPA023313.
HPA023313
HPA023313
HPA023313