Anti-GSDMA Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GSDMA Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023313
• Supplier Catalog Number: HPA023313
• Alternative Catalog Number: ATA-HPA023313-100,ATA-HPA023313-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ39120, GSDM, GSDM1

Product Description

gasdermin A

Additional Information

Anti-GSDMA

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 284110
• UniProt: Q96QA5
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GSDMA
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA023313 antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human lymph node, skin, skin and skin, hairy using Anti-GSDMA antibody HPA023313 (A) shows similar protein distribution across tissues to independent antibody HPA064826 (B).

Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemical staining of human lymph node using Anti-GSDMA antibody HPA023313.

Immunohistochemical staining of human skin, hairy using Anti-GSDMA antibody HPA023313.

HPA023313

HPA023313

HPA023313