Anti-SCRIB Antibody , Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-SCRIB Antibody , Unconjugated, Rabbit, Polyclonal
• Artikelnummer: ATA-HPA023557
• Hersteller Artikelnummer: HPA023557
• Alternativnummer: ATA-HPA023557-100,ATA-HPA023557-25
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: KIAA0147, SCRB1, Vartul

Produktbeschreibung

scribbled planar cell polarity protein

Zusatzinformationen

Anti-SCRIB

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.4 mg/ml
• Isotyp: IgG
• NCBI: 23513
• UniProt: Q14160
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target-Kategorie: SCRIB
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml

Bilder

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.

Immunohistochemistry analysis in human skin and liver tissues using HPA023557 antibody. Corresponding SCRIB RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.

Western blot analysis in human cell lines MCF-7 and Caco-2 using Anti-SCRIB antibody. Corresponding SCRIB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

HPA023557

HPA023557