Anti-SCRIB
Artikelnummer:
ATA-HPA023557
- Bilder (9)
| Artikelname: | Anti-SCRIB |
| Artikelnummer: | ATA-HPA023557 |
| Hersteller Artikelnummer: | HPA023557 |
| Alternativnummer: | ATA-HPA023557-100,ATA-HPA023557-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0147, SCRB1, Vartul |
| scribbled planar cell polarity protein |
| Anti-SCRIB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23513 |
| UniProt: | Q14160 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCRIB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. |
|
|
Immunohistochemistry analysis in human skin and liver tissues using HPA023557 antibody. Corresponding SCRIB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes. |
|
|
Western blot analysis in human cell lines MCF-7 and Caco-2 using Anti-SCRIB antibody. Corresponding SCRIB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA023557-100ul |
|
|
HPA023557-100ul |
Produktgarantie und fachkundiger Support
