Anti-SCRIB

Catalog Number: ATA-HPA023557
Article Name: Anti-SCRIB
Biozol Catalog Number: ATA-HPA023557
Supplier Catalog Number: HPA023557
Alternative Catalog Number: ATA-HPA023557-100,ATA-HPA023557-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0147, SCRB1, Vartul
scribbled planar cell polarity protein
Anti-SCRIB
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 23513
UniProt: Q14160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SCRIB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.
Immunohistochemistry analysis in human skin and liver tissues using HPA023557 antibody. Corresponding SCRIB RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.
Western blot analysis in human cell lines MCF-7 and Caco-2 using Anti-SCRIB antibody. Corresponding SCRIB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
HPA023557-100ul
HPA023557-100ul