Anti-SCRIB Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SCRIB Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023557
• Supplier Catalog Number: HPA023557
• Alternative Catalog Number: ATA-HPA023557-100,ATA-HPA023557-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: KIAA0147, SCRB1, Vartul

Product Description

scribbled planar cell polarity protein

Additional Information

Anti-SCRIB

Product Properties

• Clonality: Polyclonal
• Concentration: 0.4 mg/ml
• Isotype: IgG
• NCBI: 23513
• UniProt: Q14160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SCRIB
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.

Immunohistochemistry analysis in human skin and liver tissues using HPA023557 antibody. Corresponding SCRIB RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.

Western blot analysis in human cell lines MCF-7 and Caco-2 using Anti-SCRIB antibody. Corresponding SCRIB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

HPA023557

HPA023557