Anti-NXN

Artikelnummer: ATA-HPA023566
Artikelname: Anti-NXN
Artikelnummer: ATA-HPA023566
Hersteller Artikelnummer: HPA023566
Alternativnummer: ATA-HPA023566-100,ATA-HPA023566-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ12614, NRX
nucleoredoxin
Anti-NXN
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 64359
UniProt: Q6DKJ4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NXN
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus.
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-NXN antibody. Corresponding NXN RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA023566-100ul
HPA023566-100ul
HPA023566-100ul