Anti-NXN
Catalog Number:
ATA-HPA023566
- Images (8)
| Article Name: | Anti-NXN |
| Biozol Catalog Number: | ATA-HPA023566 |
| Supplier Catalog Number: | HPA023566 |
| Alternative Catalog Number: | ATA-HPA023566-100,ATA-HPA023566-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12614, NRX |
| nucleoredoxin |
| Anti-NXN |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 64359 |
| UniProt: | Q6DKJ4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAFVNDFLAEKLKPEPI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NXN |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells. |
|
|
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-NXN antibody. Corresponding NXN RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA023566-100ul |
|
|
HPA023566-100ul |
|
|
HPA023566-100ul |
Product Guarantee and Expert Support
