Anti-NAA15
Artikelnummer:
ATA-HPA023589
- Bilder (8)
| Artikelname: | Anti-NAA15 |
| Artikelnummer: | ATA-HPA023589 |
| Hersteller Artikelnummer: | HPA023589 |
| Alternativnummer: | ATA-HPA023589-100,ATA-HPA023589-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ13340, NARG1, NATH, TBDN100 |
| N(alpha)-acetyltransferase 15, NatA auxiliary subunit |
| Anti-NAA15 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80155 |
| UniProt: | Q9BXJ9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NAA15 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in human cell line Daudi. |
|
|
HPA023589-100ul |
|
|
|
|
|
|
|
|
HPA023589-100ul |
|
|
HPA023589-100ul |
Produktgarantie und fachkundiger Support
