Anti-NAA15

Catalog Number: ATA-HPA023589
Article Name: Anti-NAA15
Biozol Catalog Number: ATA-HPA023589
Supplier Catalog Number: HPA023589
Alternative Catalog Number: ATA-HPA023589-100,ATA-HPA023589-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ13340, NARG1, NATH, TBDN100
N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Anti-NAA15
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 80155
UniProt: Q9BXJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NAA15
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
Western blot analysis in human cell line Daudi.
HPA023589-100ul
HPA023589-100ul
HPA023589-100ul