Anti-UBE2O

Artikelnummer: ATA-HPA023605
Artikelname: Anti-UBE2O
Artikelnummer: ATA-HPA023605
Hersteller Artikelnummer: HPA023605
Alternativnummer: ATA-HPA023605-100,ATA-HPA023605-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: E2-230K
ubiquitin-conjugating enzyme E2O
Anti-UBE2O
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 63893
UniProt: Q9C0C9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: UBE2O
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to nuclear bodies.
Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemical staining of human testis shows strong positivity in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells and Neuropil.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA023605-100ul
HPA023605-100ul