Anti-UBE2O

Catalog Number: ATA-HPA023605
Article Name: Anti-UBE2O
Biozol Catalog Number: ATA-HPA023605
Supplier Catalog Number: HPA023605
Alternative Catalog Number: ATA-HPA023605-100,ATA-HPA023605-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: E2-230K
ubiquitin-conjugating enzyme E2O
Anti-UBE2O
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 63893
UniProt: Q9C0C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UBE2O
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to nuclear bodies.
Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemical staining of human testis shows strong positivity in Leydig cells.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells and Neuropil.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA023605-100ul
HPA023605-100ul