Anti-UBE2O Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-UBE2O Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA023605
• Supplier Catalog Number: HPA023605
• Alternative Catalog Number: ATA-HPA023605-100,ATA-HPA023605-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: E2-230K

Product Description

ubiquitin-conjugating enzyme E2O

Additional Information

Anti-UBE2O

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 63893
• UniProt: Q9C0C9
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: UBE2O
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A549 shows localization to nuclear bodies.

Immunohistochemical staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemical staining of human testis shows strong positivity in Leydig cells.

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells and Neuropil.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA023605

HPA023605