Anti-FBF1
Artikelnummer:
ATA-HPA023677
- Bilder (8)
| Artikelname: | Anti-FBF1 |
| Artikelnummer: | ATA-HPA023677 |
| Hersteller Artikelnummer: | HPA023677 |
| Alternativnummer: | ATA-HPA023677-100,ATA-HPA023677-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALB, FBF-1, FLJ00103, KIAA1863 |
| Fas (TNFRSF6) binding factor 1 |
| Anti-FBF1 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 85302 |
| UniProt: | Q8TES7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FBF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to centrosome. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human fallopian tube shows weak membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA023677-100ul |
|
|
|
|
|
HPA023677-100ul |
|
|
HPA023677-100ul |
Produktgarantie und fachkundiger Support
