Anti-FBF1
Catalog Number:
ATA-HPA023677
- Images (8)
| Article Name: | Anti-FBF1 |
| Biozol Catalog Number: | ATA-HPA023677 |
| Supplier Catalog Number: | HPA023677 |
| Alternative Catalog Number: | ATA-HPA023677-100,ATA-HPA023677-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ALB, FBF-1, FLJ00103, KIAA1863 |
| Fas (TNFRSF6) binding factor 1 |
| Anti-FBF1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 85302 |
| UniProt: | Q8TES7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FBF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to centrosome. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human fallopian tube shows weak membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA023677-100ul |
|
|
|
|
|
HPA023677-100ul |
|
|
HPA023677-100ul |
Product Guarantee and Expert Support
