Anti-CHMP4C

Artikelnummer: ATA-HPA023799
Artikelname: Anti-CHMP4C
Artikelnummer: ATA-HPA023799
Hersteller Artikelnummer: HPA023799
Alternativnummer: ATA-HPA023799-100,ATA-HPA023799-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC22825, Shax3, VPS32C
charged multivesicular body protein 4C
Anti-CHMP4C
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 92421
UniProt: Q96CF2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CHMP4C
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human small intestine and testis tissues using Anti-CHMP4C antibody. Corresponding CHMP4C RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and CHMP4C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407666).
HPA023799-100ul
HPA023799-100ul
HPA023799-100ul