Anti-CHMP4C
Catalog Number:
ATA-HPA023799
- Images (7)
| Article Name: | Anti-CHMP4C |
| Biozol Catalog Number: | ATA-HPA023799 |
| Supplier Catalog Number: | HPA023799 |
| Alternative Catalog Number: | ATA-HPA023799-100,ATA-HPA023799-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MGC22825, Shax3, VPS32C |
| charged multivesicular body protein 4C |
| Anti-CHMP4C |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 92421 |
| UniProt: | Q96CF2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHMP4C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human small intestine and testis tissues using Anti-CHMP4C antibody. Corresponding CHMP4C RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
Immunohistochemical staining of human small intestine shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and CHMP4C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407666). |
|
|
HPA023799-100ul |
|
|
HPA023799-100ul |
|
|
HPA023799-100ul |
Product Guarantee and Expert Support
