Anti-CASK Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA023857
Artikelname: Anti-CASK Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA023857
Hersteller Artikelnummer: HPA023857
Alternativnummer: ATA-HPA023857-100,ATA-HPA023857-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAGH39, FGS4, LIN2, TNRC8
calcium/calmodulin-dependent serine protein kinase (MAGUK family)
Anti-CASK
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 8573
UniProt: O14936
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CASK
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human duodenum and testis tissues using Anti-CASK antibody. Corresponding CASK RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA023857
HPA023857
HPA023857