Anti-CASK

Catalog Number: ATA-HPA023857
Article Name: Anti-CASK
Biozol Catalog Number: ATA-HPA023857
Supplier Catalog Number: HPA023857
Alternative Catalog Number: ATA-HPA023857-100,ATA-HPA023857-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAGH39, FGS4, LIN2, TNRC8
calcium/calmodulin-dependent serine protein kinase (MAGUK family)
Anti-CASK
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8573
UniProt: O14936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CASK
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry analysis in human duodenum and testis tissues using Anti-CASK antibody. Corresponding CASK RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA023857-100ul
HPA023857-100ul
HPA023857-100ul