Anti-DMD
Artikelnummer:
ATA-HPA023885
- Bilder (7)
| Artikelname: | Anti-DMD |
| Artikelnummer: | ATA-HPA023885 |
| Hersteller Artikelnummer: | HPA023885 |
| Alternativnummer: | ATA-HPA023885-100,ATA-HPA023885-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BMD, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85 |
| dystrophin |
| Anti-DMD |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 1756 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DMD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skeletal muscle and tonsil tissues using HPA023885 antibody. Corresponding DMD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong membranous positivity in myocytes. |
|
|
Immunohistochemical staining of human heart muscle shows strong membranous positivity in myocytes. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected. |
|
|
HPA023885-100ul |
|
|
HPA023885-100ul |
|
|
HPA023885-100ul |
Produktgarantie und fachkundiger Support
