Anti-DMD
Catalog Number:
ATA-HPA023885
- Images (7)
| Article Name: | Anti-DMD |
| Biozol Catalog Number: | ATA-HPA023885 |
| Supplier Catalog Number: | HPA023885 |
| Alternative Catalog Number: | ATA-HPA023885-100,ATA-HPA023885-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BMD, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85 |
| dystrophin |
| Anti-DMD |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 1756 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DMD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human skeletal muscle and tonsil tissues using HPA023885 antibody. Corresponding DMD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong membranous positivity in myocytes. |
|
|
Immunohistochemical staining of human heart muscle shows strong membranous positivity in myocytes. |
|
|
Immunohistochemical staining of human tonsil shows no positivity as expected. |
|
|
HPA023885-100ul |
|
|
HPA023885-100ul |
|
|
HPA023885-100ul |
Product Guarantee and Expert Support
