Anti-DEPTOR Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA023938
Artikelname: Anti-DEPTOR Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA023938
Hersteller Artikelnummer: HPA023938
Alternativnummer: ATA-HPA023938-100,ATA-HPA023938-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DEP.6, DEPDC6, FLJ12428
DEP domain containing MTOR-interacting protein
Anti-DEPTOR
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 64798
UniProt: Q8TB45
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DEPTOR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-DEPTOR antibody. Corresponding DEPTOR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA023938
HPA023938
HPA023938