Anti-DEPTOR

Catalog Number: ATA-HPA023938
Article Name: Anti-DEPTOR
Biozol Catalog Number: ATA-HPA023938
Supplier Catalog Number: HPA023938
Alternative Catalog Number: ATA-HPA023938-100,ATA-HPA023938-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DEP.6, DEPDC6, FLJ12428
DEP domain containing MTOR-interacting protein
Anti-DEPTOR
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 64798
UniProt: Q8TB45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DEPTOR
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-DEPTOR antibody. Corresponding DEPTOR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA023938-100ul
HPA023938-100ul
HPA023938-100ul