Anti-EIF3E Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA023973
- Bilder (9)
| Artikelname: | Anti-EIF3E Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA023973 |
| Hersteller Artikelnummer: | HPA023973 |
| Alternativnummer: | ATA-HPA023973-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | eIF3-p48, eIF3e, EIF3S6, INT6 |
| eukaryotic translation initiation factor 3, subunit E |
| Anti-EIF3E |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3646 |
| UniProt: | P60228 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EIF3E |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF3E antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA023973 |
|
|
|
|
|
|
|
|
HPA023973 |
|
|
HPA023973 |
Produktgarantie und fachkundiger Support
