Anti-EIF3E

Catalog Number: ATA-HPA023973
Article Name: Anti-EIF3E
Biozol Catalog Number: ATA-HPA023973
Supplier Catalog Number: HPA023973
Alternative Catalog Number: ATA-HPA023973-100,ATA-HPA023973-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: eIF3-p48, eIF3e, EIF3S6, INT6
eukaryotic translation initiation factor 3, subunit E
Anti-EIF3E
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 3646
UniProt: P60228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: EIF3E
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF3E antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA023973-100ul
HPA023973-100ul
HPA023973-100ul