Anti-PHGDH

Artikelnummer: ATA-HPA024031
Artikelname: Anti-PHGDH
Artikelnummer: ATA-HPA024031
Hersteller Artikelnummer: HPA024031
Alternativnummer: ATA-HPA024031-100,ATA-HPA024031-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PDG, PGDH, SERA
phosphoglycerate dehydrogenase
Anti-PHGDH
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 26227
UniProt: O43175
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PHGDH
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemical staining of human cervix, uterine shows nuclear and cytoplasmic positivity in squamous cells.
Western blot analysis using Anti-PHGDH antibody HPA024031 (A) shows similar pattern to independent antibody HPA021241 (B).
HPA024031-100ul
HPA024031-100ul
HPA024031-100ul