Anti-PHGDH
Catalog Number:
ATA-HPA024031
- Images (8)
| Article Name: | Anti-PHGDH |
| Biozol Catalog Number: | ATA-HPA024031 |
| Supplier Catalog Number: | HPA024031 |
| Alternative Catalog Number: | ATA-HPA024031-100,ATA-HPA024031-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PDG, PGDH, SERA |
| phosphoglycerate dehydrogenase |
| Anti-PHGDH |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 26227 |
| UniProt: | O43175 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PHGDH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human cervix, uterine shows nuclear and cytoplasmic positivity in squamous cells. |
|
|
Western blot analysis using Anti-PHGDH antibody HPA024031 (A) shows similar pattern to independent antibody HPA021241 (B). |
|
|
HPA024031-100ul |
|
|
|
|
|
|
|
|
HPA024031-100ul |
|
|
HPA024031-100ul |
Product Guarantee and Expert Support
