Anti-CHRM3
Artikelnummer:
ATA-HPA024106
- Bilder (7)
| Artikelname: | Anti-CHRM3 |
| Artikelnummer: | ATA-HPA024106 |
| Hersteller Artikelnummer: | HPA024106 |
| Alternativnummer: | ATA-HPA024106-100,ATA-HPA024106-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CHRM3 |
| cholinergic receptor, muscarinic 3 |
| Anti-CHRM3 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 1131 |
| UniProt: | P20309 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHRM3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in a subset of neurons. |
|
|
Immunohistochemical staining of human gastrointestinal shows very strong cytoplasmic positivity in Paneth cells. |
|
|
HPA024106-100ul |
|
|
HPA024106-100ul |
|
|
HPA024106-100ul |
Produktgarantie und fachkundiger Support
