Anti-CHRM3
Catalog Number:
ATA-HPA024106
- Images (7)
| Article Name: | Anti-CHRM3 |
| Biozol Catalog Number: | ATA-HPA024106 |
| Supplier Catalog Number: | HPA024106 |
| Alternative Catalog Number: | ATA-HPA024106-100,ATA-HPA024106-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CHRM3 |
| cholinergic receptor, muscarinic 3 |
| Anti-CHRM3 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 1131 |
| UniProt: | P20309 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHRM3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in a subset of neurons. |
|
|
Immunohistochemical staining of human gastrointestinal shows very strong cytoplasmic positivity in Paneth cells. |
|
|
HPA024106-100ul |
|
|
HPA024106-100ul |
|
|
HPA024106-100ul |
Product Guarantee and Expert Support
