Anti-SYVN1

Artikelnummer: ATA-HPA024300
Artikelname: Anti-SYVN1
Artikelnummer: ATA-HPA024300
Hersteller Artikelnummer: HPA024300
Alternativnummer: ATA-HPA024300-100,ATA-HPA024300-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DER3, HRD1
synovial apoptosis inhibitor 1, synoviolin
Anti-SYVN1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 84447
UniProt: Q86TM6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SYVN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody HPA024300 (A) shows similar protein distribution across tissues to independent antibody HPA005480 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human lymph node using Anti-SYVN1 antibody HPA024300.
Immunohistochemical staining of human cerebral cortex using Anti-SYVN1 antibody HPA024300.
HPA024300-100ul
HPA024300-100ul
HPA024300-100ul