Anti-SYVN1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SYVN1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024300
• Supplier Catalog Number: HPA024300
• Alternative Catalog Number: ATA-HPA024300-100,ATA-HPA024300-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DER3, HRD1

Product Description

synovial apoptosis inhibitor 1, synoviolin

Additional Information

Anti-SYVN1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 84447
• UniProt: Q86TM6
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SYVN1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody HPA024300 (A) shows similar protein distribution across tissues to independent antibody HPA005480 (B).

Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemical staining of human tonsil shows high expression.

Immunohistochemical staining of human lymph node using Anti-SYVN1 antibody HPA024300.

Immunohistochemical staining of human cerebral cortex using Anti-SYVN1 antibody HPA024300.

HPA024300

HPA024300

HPA024300