Anti-SYVN1

Catalog Number: ATA-HPA024300
Article Name: Anti-SYVN1
Biozol Catalog Number: ATA-HPA024300
Supplier Catalog Number: HPA024300
Alternative Catalog Number: ATA-HPA024300-100,ATA-HPA024300-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DER3, HRD1
synovial apoptosis inhibitor 1, synoviolin
Anti-SYVN1
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 84447
UniProt: Q86TM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SYVN1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using Anti-SYVN1 antibody. Corresponding SYVN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-SYVN1 antibody HPA024300 (A) shows similar protein distribution across tissues to independent antibody HPA005480 (B).
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human lymph node using Anti-SYVN1 antibody HPA024300.
Immunohistochemical staining of human cerebral cortex using Anti-SYVN1 antibody HPA024300.
HPA024300-100ul
HPA024300-100ul
HPA024300-100ul