Anti-GCN1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA024367
Artikelname: Anti-GCN1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA024367
Hersteller Artikelnummer: HPA024367
Alternativnummer: ATA-HPA024367-100,ATA-HPA024367-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GCN1L, GCN1L1, KIAA0219
GCN1 eIF2 alpha kinase activator homolog
Anti-GCN1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10985
UniProt: Q92616
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GCN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human testis and liver tissues using Anti-GCN1 antibody. Corresponding GCN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-GCN1 antibody HPA024367 (A) shows similar protein distribution across tissues to independent antibody HPA018799 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-GCN1 antibody HPA024367.
Immunohistochemical staining of human colon using Anti-GCN1 antibody HPA024367.
HPA024367
HPA024367
HPA024367