Anti-GCN1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GCN1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA024367
• Supplier Catalog Number: HPA024367
• Alternative Catalog Number: ATA-HPA024367-100,ATA-HPA024367-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GCN1L, GCN1L1, KIAA0219

Product Description

GCN1 eIF2 alpha kinase activator homolog

Additional Information

Anti-GCN1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 10985
• UniProt: Q92616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GCN1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human testis and liver tissues using Anti-GCN1 antibody. Corresponding GCN1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-GCN1 antibody HPA024367 (A) shows similar protein distribution across tissues to independent antibody HPA018799 (B).

Immunohistochemical staining of human testis shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

Immunohistochemical staining of human cerebral cortex using Anti-GCN1 antibody HPA024367.

Immunohistochemical staining of human colon using Anti-GCN1 antibody HPA024367.

HPA024367

HPA024367

HPA024367