Anti-GCN1

Catalog Number: ATA-HPA024367
Article Name: Anti-GCN1
Biozol Catalog Number: ATA-HPA024367
Supplier Catalog Number: HPA024367
Alternative Catalog Number: ATA-HPA024367-100,ATA-HPA024367-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCN1L, GCN1L1, KIAA0219
GCN1 eIF2 alpha kinase activator homolog
Anti-GCN1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10985
UniProt: Q92616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GCN1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human testis and liver tissues using Anti-GCN1 antibody. Corresponding GCN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-GCN1 antibody HPA024367 (A) shows similar protein distribution across tissues to independent antibody HPA018799 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex using Anti-GCN1 antibody HPA024367.
Immunohistochemical staining of human colon using Anti-GCN1 antibody HPA024367.
HPA024367-100ul
HPA024367-100ul
HPA024367-100ul