Anti-FHOD1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA024468
Artikelname: Anti-FHOD1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA024468
Hersteller Artikelnummer: HPA024468
Alternativnummer: ATA-HPA024468-100,ATA-HPA024468-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FHOS
formin homology 2 domain containing 1
Anti-FHOD1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 29109
UniProt: Q9Y613
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AMPNEAGGHPDARQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FHOD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.
HPA024468
HPA024468
HPA024468